Membrane interactions of microgels as carriers of antimicrobial peptides

Research output: Contribution to journal › Journal article › Research › peer-review

Standard

Membrane interactions of microgels as carriers of antimicrobial peptides. / Nordström, Randi; Nyström, Lina; Andrén, Oliver C J; Malkoch, Michael; Umerska, Anita; Davoudi, Mina; Schmidtchen, Artur; Malmsten, Martin.

In: Journal of Colloid and Interface Science, Vol. 513, 01.03.2018, p. 141-150.

Research output: Contribution to journal › Journal article › Research › peer-review

Harvard

Nordström, R, Nyström, L, Andrén, OCJ, Malkoch, M, Umerska, A, Davoudi, M, Schmidtchen, A & Malmsten, M 2018, 'Membrane interactions of microgels as carriers of antimicrobial peptides', Journal of Colloid and Interface Science, vol. 513, pp. 141-150. https://doi.org/10.1016/j.jcis.2017.11.014

APA

Nordström, R., Nyström, L., Andrén, O. C. J., Malkoch, M., Umerska, A., Davoudi, M., Schmidtchen, A., & Malmsten, M. (2018). Membrane interactions of microgels as carriers of antimicrobial peptides. Journal of Colloid and Interface Science, 513, 141-150. https://doi.org/10.1016/j.jcis.2017.11.014

Vancouver

Nordström R, Nyström L, Andrén OCJ, Malkoch M, Umerska A, Davoudi M et al. Membrane interactions of microgels as carriers of antimicrobial peptides. Journal of Colloid and Interface Science. 2018 Mar 1;513:141-150. https://doi.org/10.1016/j.jcis.2017.11.014

Author

Nordström, Randi ; Nyström, Lina ; Andrén, Oliver C J ; Malkoch, Michael ; Umerska, Anita ; Davoudi, Mina ; Schmidtchen, Artur ; Malmsten, Martin. / Membrane interactions of microgels as carriers of antimicrobial peptides. In: Journal of Colloid and Interface Science. 2018 ; Vol. 513. pp. 141-150.

Bibtex

@article{23da52919b6b4759bca0cf4b3076be70,

title = "Membrane interactions of microgels as carriers of antimicrobial peptides",

abstract = "Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.",

keywords = "Anti-Bacterial Agents/chemistry, Antimicrobial Cationic Peptides/chemistry, Bacteria/drug effects, Cell Membrane/metabolism, Gels/chemistry, Surface Properties",

author = "Randi Nordstr{\"o}m and Lina Nystr{\"o}m and Andr{\'e}n, {Oliver C J} and Michael Malkoch and Anita Umerska and Mina Davoudi and Artur Schmidtchen and Martin Malmsten",

year = "2018",

month = mar,

day = "1",

doi = "10.1016/j.jcis.2017.11.014",

language = "English",

volume = "513",

pages = "141--150",

journal = "Journal of Colloid and Interface Science",

issn = "0021-9797",

publisher = "Academic Press",

}

RIS

TY - JOUR

T1 - Membrane interactions of microgels as carriers of antimicrobial peptides

AU - Nordström, Randi

AU - Nyström, Lina

AU - Andrén, Oliver C J

AU - Malkoch, Michael

AU - Umerska, Anita

AU - Davoudi, Mina

AU - Schmidtchen, Artur

AU - Malmsten, Martin

PY - 2018/3/1

Y1 - 2018/3/1

N2 - Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.

AB - Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.

KW - Anti-Bacterial Agents/chemistry

KW - Antimicrobial Cationic Peptides/chemistry

KW - Bacteria/drug effects

KW - Cell Membrane/metabolism

KW - Gels/chemistry

KW - Surface Properties

U2 - 10.1016/j.jcis.2017.11.014

DO - 10.1016/j.jcis.2017.11.014

M3 - Journal article

C2 - 29145017

VL - 513

SP - 141

EP - 150

JO - Journal of Colloid and Interface Science

JF - Journal of Colloid and Interface Science

SN - 0021-9797

ER -

ID: 214647941

Department of Pharmacy